PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi008222
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family GRAS
Protein Properties Length: 229aa    MW: 24316.6 Da    PI: 9.2243
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S42988776PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS48.81.2e-15102158258
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs 58 
                ve+Ll++Aeav+ g l  aqa+Larl+++ sp g+p++R+a+yf+eALa+r+++++s
  Psi008222 102 VEQLLKAAEAVELGTLDHAQAILARLNQHLSPLGKPLHRAAFYFKEALASRILNTTS 158
                799*************************************************99544 PP

2GRAS32.31.3e-10158226249327
       GRAS 249 nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                +++sF+++fleal++ys lfdsl+a    + ++ +k+E++ll+++i   ++ + a           W+  + +aGF+p+
  Psi008222 158 SAASFVHHFLEALQFYSFLFDSLDAV-NITMDAVHKIEKFLLAPKIDATISSAAAP---------PWKTLFAAAGFSPA 226
                6789*******************776.5799*******************998876.........9*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098511.74875229IPR005202Transcription factor GRAS
PfamPF035144.3E-13102158IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
XTRGMLSRTS GNSLPPAQLK HQILQSKTSP VQAQKRHCKS SVWQRSRSGG EIEPTSVLDI  60
RSPSPTSTLS SSLGGSSESA GAVAAVSGGL LCAAAEEVQV IVEQLLKAAE AVELGTLDHA  120
QAILARLNQH LSPLGKPLHR AAFYFKEALA SRILNTTSAA SFVHHFLEAL QFYSFLFDSL  180
DAVNITMDAV HKIEKFLLAP KIDATISSAA APPWKTLFAA AGFSPALIN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.100900.0needle
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264405.13e-18PREDICTED: scarecrow-like protein 27
TrEMBLA0A0K0M7B75e-37A0A0K0M7B7_PINTB; HAM1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-13GRAS family protein